- CAS
- 885340-08-9
- Formula
- C212H350N56O78S
- MW
- 4963.44 g/mol
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Form
- White lyophilized powder
- Storage
- -20°C recommended, protect from light
- Purity
- ≥99.1% HPLC
TB-500
Thymosin beta-4 fragment analog, 43 amino acids. ≥99% purity. Studied for actin sequestration, cell migration and angiogenesis in preclinical research.
For Research Purposes Only • Not For Human Consumption
Earn up to 36 points.- Lot-specific COA, QR-verifiable
- Lot number on your order line
- Dispatched from the United States
Packs of 10 vials: $12.00 each after 3 orders (Atelier) · $10.00 each after 6 orders (Laboratory)
Next lot
Be told when the next tested lot of TB-500 is released: the certificate link the moment it posts, and a 48-hour early window with 5% off that lot. One message per lot, nothing else.
Overview
TB-500 (Thymosin Beta-4 Fragment) is a synthetic 43-amino acid peptide fragment of Thymosin Beta-4. Extensively studied for its role in actin regulation and cell migration.
Published Research
Published literature has examined TB-500 across multiple research contexts:
- Actin-binding and sequestration in preclinical cellular models
- Cell migration and differentiation pathways in published literature
- Interaction with inflammatory signaling cascades in preclinical models
- Extracellular matrix remodeling and tissue organization research
| Molecular Formula | C212H350N56O78S |
|---|---|
| Molecular Weight | 4963.44 g/mol |
| Monoisotopic Mass | 4960.5 Da |
| CAS Number | 885340-08-9 |
| Amino Acid Count | 43 |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Purity | ≥99.1% (HPLC verified) |
| Physical Form | White lyophilized powder |
| Storage | -20°C recommended, protect from light |
| PubChem CID | 62707662 |
| SKU | TB500-2MG |
• Wound biology: Preclinical studies have examined Tβ4's effects on keratinocyte and endothelial cell migration in scratch-wound assays (Malinda et al., 1999).
• Cardiac biology: Animal models of myocardial infarction have been used to study Tβ4's effects on cardiomyocyte survival and epicardial progenitor activation (Smart et al., 2007).
• Ocular biology: Research in corneal wound models has investigated Tβ4's effects on epithelial healing and inflammation (Sosne et al., 2005).
• Musculoskeletal research: Studies have assessed TB-500 in tendon and muscle injury models in rodents.
Standard reconstitution: 1 mL bacteriostatic water per vial unless otherwise specified on the Certificate of Analysis. Store reconstituted solution at 2-8°C and use within 30 days. Lyophilized powder stable at -20°C for 24 months when sealed under inert atmosphere.
Every lot ships with a third-party HPLC certificate. View the most recent lot certificate via the COA Portal. Mass spectrometry confirmation available on request.
Only logged in customers who have purchased this product may leave a review.
Free shipping on orders over $49, bacteriostatic water included. Orders placed before 2 PM ET dispatch same business day from Salt Lake City via FedEx 2Day. International shipping via DHL Express. Returns accepted for damaged or short-shipped product within 30 days of delivery.
Reserve next allocation.
Atelier-list researchers receive ten percent on first order plus lot release notifications before public catalog drop.
Request Access
Reviews
There are no reviews yet.