99%+ HPLC Purity COA Included Ships Same Day Before 2 PM ET Third-Party Verified Lyophilized for Stability Mass Spec Confirmed ISO 9001 Facility

Get Free Shipping On Orders Over $200

⚠ For Research Use Only|Not for Human Consumption|Certificate of Analysis Available
Exclusive Access

Join the Aureum Circle

Create your free researcher account and unlock premium benefits with every order.

10% welcome discount
Earn points every order
Early access new peptides
Free priority ship $150+
Track orders & reorder
Member-only pricing
By signing up, you agree to our Terms and Privacy Policy
You're $200.00 away from complimentary shipping
PEPTIDES

TB-500

Thymosin Beta-4, Tβ4 fragment, TB4

Sequence
43 AA
Mol. Weight
4963.44
CAS
77591-33-4
Purity
99.1
99.1 Purity
COA Included
Same-Day Dispatch
Thymosin Beta-4 analog (43 amino acids). ≥99% purity. 5mg lyophilized. Studied for cell migration, angiogenesis, and actin-sequestering activity in preclinical research.
Starting From
Price range: $33.00 through $97.00per vial
Save 15% on 3+Earn 11 pts
In Stock - Ready to Ship
100 units available
Order within 2h 14m for same-day dispatch
Estimated delivery: Jun 15 - Jun 17
Volume Pricing
1 - $33 ea
2+-10%$30 ea
Best Value3+-15%$28 ea
5+-20%$26 ea
For Research Purposes Only • Not For Human Consumption
Volume Discounts
QuantityDiscountPrice Each
1$33.00
2+Save 5%$31.35
3+Save 10%$29.70
5+Save 15%$28.05
This product is intended strictly for in vitro research and laboratory use by qualified researchers. It is not a drug, food, or cosmetic. Aureum Peptides makes no claims regarding safety or efficacy for any purpose. By purchasing, you agree to the Research Use Agreement.
99%+ Purity Guaranteed
Third-Party COA Tested
Secure Checkout
Fast & Discreet Shipping
30-Day Returns
Spend $267.00 more to unlock a free research sample
$33.00$300 goal
Free Ship $200+
Secure Checkout
30-Day Returns
Guaranteed
Join Aureum Circle - Unlock 10% Off
Free researcher account. Earn rewards. Get exclusive pricing.
Earn points
Early access
Track orders
Join Free
Complete Your Stack
Save 10%
BPC-157
BPC-157
Price range: $22.50 through $37.00
GHK-Cu
GHK-Cu
Price range: $18.00 through $50.00
Bacteriostatic water
Bacteriostatic water
Price range: $3.50 through $8.00
Bundle Total
$0.00
Get 10% Off Your First Order
Join 12,000+ researchers. Exclusive pricing, restock alerts, and new product launches.
VISAMASTERCARDAMEXPAYPAL256-bit SSL
SKU: TB500-2MG

Research Catalog  —  N° TB500-2MG

Order in --h --m for same-day dispatch
2+ save 5% 3+ save 10% 5+ save 15%
Tier discount applies automatically at checkout per SKU quantity.
Ships Monday, Jun 15
Estimated delivery: Jun 17 – Jun 22
Certificate of Analysis
99.1%+ purity HPLC verified Third-party tested
View batch-specific COA
📦 Ships next business day
Standard delivery: Jun 18 – Jun 22  |  Express: Jun 16 – Jun 17
Free shipping on orders $200+ Ships same day before 2PM EST Temperature-controlled packaging available

Quality & Transparency

Every batch tested. Every result published. No exceptions.

0
Verified Purity %
Janssen Analytical Laboratories
Testing Partner
#TB5-2026-04
Current Batch
Available
COA on Request
Overview

TB-500 is a synthetic analog of Thymosin Beta-4 (Tβ4), a 43-amino acid peptide originally isolated from the thymus gland. Tβ4 is a major actin-sequestering molecule found in virtually all mammalian cells and is one of the most abundant intracellular peptides. TB-500 has been extensively studied in preclinical models for its role in cell migration, angiogenesis, and wound-related biology.

Biochemical Characteristics
Specifications
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Molecular Formula
C212H350N56O78S
Molecular Weight
4963.44 g/mol
CAS Number
77591-33-4

TB-500 corresponds to the full-length Thymosin Beta-4 sequence with a molecular weight of 4963.44 g/mol. The active domain of the peptide contains the central actin-binding motif LKKTET (residues 17-22), which is responsible for G-actin sequestration and cytoskeletal remodeling. This motif is critical for the peptide's documented effects on cell migration in in vitro assays.

The peptide is highly water-soluble and maintains structural integrity across physiological pH ranges.

Research Applications

• Wound biology: Preclinical studies have examined Tβ4's effects on keratinocyte and endothelial cell migration in scratch-wound assays (Malinda et al., 1999).
• Cardiac biology: Animal models of myocardial infarction have been used to study Tβ4's effects on cardiomyocyte survival and epicardial progenitor activation (Smart et al., 2007).
• Ocular biology: Research in corneal wound models has investigated Tβ4's effects on epithelial healing and inflammation (Sosne et al., 2005).
• Musculoskeletal research: Studies have assessed TB-500 in tendon and muscle injury models in rodents.

Pathway Context

• G-actin sequestration and cytoskeletal dynamics regulation
• HIF-1α stabilization in hypoxic conditions
• VEGF pathway modulation in angiogenesis models
• NF-κB pathway interaction in inflammatory models
• Wt1+ epicardial progenitor cell activation in cardiac models

Preclinical Research

Key preclinical findings with published concentrations:

Smart et al. (2007, Nature): Tβ4 priming activated Wt1+ epicardial progenitor cells in murine myocardial infarction model. Dose: 150 µg injected systemically. Improved neovascularization and reduced scar size.

Malinda et al. (1999): Tβ4 at 100 ng/mL promoted endothelial cell migration (2.5-fold increase) and tube formation in Matrigel assays. EC50 for migration: ~6 nM.

Sosne et al. (2005): Accelerated corneal epithelial wound closure by 25% in rat model. Topical application at 0.1% concentration. Reduced TNF-α and MMP-9 expression.

Philp et al. (2004): Tβ4 at 4.2 mg/kg improved full-thickness dermal wound closure rate by 2-fold in diabetic mouse model.

Typical in vitro concentrations: 1-1000 ng/mL (cell culture). In vivo: 2-6 mg/kg (rodent studies).

All findings from animal or in vitro studies.

Form & Analytical Testing

Form: Lyophilized powder, 5mg per vial
Appearance: White powder
Molecular Weight: 4963.44 g/mol
For In Vitro Research Use Only

Laboratory Preparation:
Add sterile diluent to vial. Gently swirl to dissolve.

Solubility Profile: Freely soluble in water (>20 mg/mL), PBS, cell culture media.

Stability: Lyophilized stable 24 months at -20°C. Solution: 30 days at 2-8°C.

Analytical Testing: HPLC (≥99%), ESI-MS, LAL endotoxin (<0.1 EU/mg), USP sterility.

This product is for laboratory and in vitro research only. Not for human or animal use.

Article Author
DS
Article Author
Dr. Sarah Chen, Ph.D.

Biochemistry researcher specializing in peptide characterization and analytical chemistry.

This content was prepared for informational purposes based on published preclinical research. It does not constitute medical advice or product efficacy claims.

Citations
  1. 1
    Smart N, et al. "Thymosin beta4 induces adult epicardial progenitor mobilization and neovascularization." Nature. 2007;445(7124):177-82. PubMed: 17108969 PubMed
  2. 2
    Malinda KM, et al. "Thymosin beta4 accelerates wound healing." J Invest Dermatol. 1999;113(3):364-8. PubMed: 10469334 PubMed
  3. 3
    Sosne G, et al. "Thymosin beta 4 promotes corneal wound healing and modulates inflammatory mediators in vivo." Exp Eye Res. 2005;81(1):23-9. PubMed: 15978250 PubMed
  4. 4
    Philp D, et al. "Thymosin beta4 increases hair growth by activation of hair follicle stem cells." FASEB J. 2004;18(2):385-7. PubMed: 14657001 PubMed
RUO Disclaimer
ALL ARTICLES AND PRODUCT INFORMATION ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. Products are for in-vitro studies only. Not approved by the FDA. Bodily introduction strictly forbidden. These products are not drugs, supplements, food, or cosmetics and may not be acquired for such purposes.

Advancing Research, One Peptide at a Time

Premium quality. Rigorous testing. Trusted by researchers worldwide.

Properties
Molecular Formula
C212H350N56O78S
Molecular Weight
4963.44 g/mol
Monoisotopic Mass
4960.50
Polar Area
414 Ų
Complexity
1530
XLogP
-8.6
Heavy Atoms
347
H-Bond Donors
62
H-Bond Acceptors
84
Rotatable Bonds
194
Identifiers
PubChem CID
16132341
InChIKey
HBOMLICNUCNMMY-XLPZGREQSA-N
SMILES
Large peptide - see PubChem CID 16132341 for full SMILES
IUPAC
(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-acetamido-4-methylpentanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-carboxybutanoyl]amino]-3-hydroxybutanoyl]amino]-5-amino-5-oxopentanoic acid
TB-500 2D Structure
Thymosin Beta-4 (TB-500) 2D Structure
Source: PubChem
99.1%
HPLC Purity
Target: ≥98%
5mg
Peptide Content
4963.4 Da
Mol. Weight (MS)
<0.1 EU/mg
Endotoxins
Pass (USP <71>)
Sterility
Janssen Analytical Laboratories
Salt Lake City, UT 84101
Verified
TestTargetResult
HPLC Purityu226598.0%99.1% ✓
Mass Spectrometry4963.4 u00b1 2.0 Da4963.4 Da ✓
Endotoxin (LAL)<0.1 EU/mg<0.05 EU/mg ✓
Sterility (USP <71>)No growthPass ✓

Temperature

Lyophilized: -20°C, protected from light
Reconstituted: 2-8°C

Shelf Life

24 months lyophilized at -20°C
30 days reconstituted at 2-8°C

Handling

Allow vial to reach room temperature before opening.
Reconstitute with bacteriostatic water.
Avoid repeated freeze-thaw cycles.

Frequently Asked Questions

TB-500 is verified at ≥99.1% purity via reverse-phase HPLC analysis. Each batch also undergoes ESI mass spectrometry for identity confirmation, LAL endotoxin testing (<0.1 EU/mg), and USP <71> sterility testing. A batch-specific Certificate of Analysis (COA) is included with every order.
Add bacteriostatic water (0.9% benzyl alcohol) slowly to the vial wall. Gently swirl to dissolve — do not shake or vortex. Reconstituted peptide should be stored at 2-8°C and used within 30 days. For single-use applications, sterile water may be substituted (no preservative, use immediately).
Lyophilized (powder): Store at -20°C, protected from light and moisture. Shelf life: 24 months. Reconstituted (solution): Store at 2-8°C, use within 30 days. Critical: Allow the vial to reach room temperature before opening to prevent moisture condensation inside the vial. Avoid repeated freeze-thaw cycles (max 3 recommended).
The CAS registry number for TB-500 is 77591-33-4. Molecular weight: 4963.44 g/mol. Molecular formula: C212H350N56O78S. Full chemical characterization data including PubChem identifiers, SMILES notation, and InChIKey are available on the Chemical Properties tab above.
Yes. Every batch of TB-500 is independently tested by Janssen Analytical Laboratories (ISO 17025-accredited). Testing includes HPLC purity analysis, mass spectrometry identity confirmation, LAL kinetic turbidimetric endotoxin assay, and USP <71> sterility testing. Full results are provided in the batch-specific COA. Additional documentation is available on the COA/HPLC/MS and 3rd Party Testing tabs above.
Orders placed before 2:00 PM EST ship same day via cold-chain logistics with gel ice packs to maintain product integrity during transit. Most domestic orders arrive within 2-4 business days. Full tracking is provided. All vials are sealed under inert atmosphere and packaged to prevent damage.
Yes. Tiered pricing is applied automatically at checkout: 2+ units at 10% off, 3+ units at 15% off, and 5+ units at 20% off. For institutional or bulk research inquiries (10+ vials), contact us at contact@aureumpeptides.com for custom pricing.
Compatibility depends on your specific experimental design. TB-500 is provided as a single-compound lyophilized preparation for maximum flexibility. When using multiple compounds, reconstitute each separately and add to experimental systems independently to avoid potential interactions during reconstitution. Check the "Researchers Also Purchased" section below for commonly paired research compounds.

Stay at the Forefront

Join our research community. Get early access to new peptides, exclusive member pricing, and curated literature reviews delivered to your inbox.

Welcome to the Circle ✦

Check your inbox for your 10% welcome discount

No spam, everUnsubscribe anytime12,000+ researchers

Frequently Studied Together

TB-500

TB-500

Price range: $33.00 through $97.00

This item
+
+
+
CA Prop 65: WARNING: This product can expose you to chemicals known to the State of California to cause cancer, birth defects, or other reproductive harm. P65Warnings.ca.gov

Share This Product

0 of 4 selected
Clear All

Research Compound Comparison

Side-by-side analysis of chemical profiles, research applications, and specifications

All products are sold strictly for in vitro research and laboratory use. Not for human consumption, therapeutic use, or veterinary use. No statements on this website have been evaluated by the FDA. Products are not intended to diagnose, treat, cure, or prevent any disease. By purchasing, you confirm you are a qualified researcher and agree to our Terms of Service. CA Prop 65 Warning: Products may contain chemicals known to the State of California to cause cancer or reproductive harm.
Research Grade Peptides
USA Based
Same-Day Shipping
99%+ Purity Verified

Stay Informed

Research Protocols
10 products
Cellular Aging Research
12 products
Metabolic Pathway Research
4 products
Neuropeptide Research
9 products
Peptides
5 products
Somatotropic Research
12 products
View All Products →

Frequently Asked Questions

What is the purity of TB-500?+
TB-500 from Aureum Peptides is synthesized to ≥99% purity and verified by third-party HPLC analysis. A Certificate of Analysis (COA) is included with every order.
Is TB-500 intended for human use?+
No. TB-500 is sold strictly for in-vitro laboratory research purposes only. Not for human consumption, therapeutic use, or veterinary use. Purchase is limited to qualified researchers and research facilities.
How is TB-500 shipped and stored?+
Orders placed before 2:00 PM EST ship the same business day from our USA facility with cold-chain logistics. Upon arrival, store TB-500 lyophilized at -20°C for long-term stability, or at 4°C for short-term storage after reconstitution.
Do you provide a Certificate of Analysis?+
Yes. Every vial of TB-500 ships with a batch-specific Certificate of Analysis documenting identity (mass spectrometry), purity (HPLC), and appearance. COAs are also accessible via our online COA portal using the batch number on your vial.
Can I order TB-500 in bulk for institutional research?+
Yes. Aureum Peptides offers institutional wholesale pricing for universities, biotech R&D, and contract research organizations. Contact us for a quote and Net-30 payment terms after credit approval.
Request a Compound
TB-500
Price range: $33.00 through $97.00
Searching...
Loading product...
Added to cart!
View Cart

Your Cart