TB-500 is a synthetic analog of Thymosin Beta-4 (Tβ4), a 43-amino acid peptide originally isolated from the thymus gland. Tβ4 is a major actin-sequestering molecule found in virtually all mammalian cells and is one of the most abundant intracellular peptides. TB-500 has been extensively studied in preclinical models for its role in cell migration, angiogenesis, and wound-related biology.
Biochemical Characteristics
Specifications
Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Molecular Formula
C212H350N56O78S
Molecular Weight
4963.44 g/mol
CAS Number
77591-33-4
TB-500 corresponds to the full-length Thymosin Beta-4 sequence with a molecular weight of 4963.44 g/mol. The active domain of the peptide contains the central actin-binding motif LKKTET (residues 17-22), which is responsible for G-actin sequestration and cytoskeletal remodeling. This motif is critical for the peptide's documented effects on cell migration in in vitro assays.
The peptide is highly water-soluble and maintains structural integrity across physiological pH ranges.
Research Applications
• Wound biology: Preclinical studies have examined Tβ4's effects on keratinocyte and endothelial cell migration in scratch-wound assays (Malinda et al., 1999).
• Cardiac biology: Animal models of myocardial infarction have been used to study Tβ4's effects on cardiomyocyte survival and epicardial progenitor activation (Smart et al., 2007).
• Ocular biology: Research in corneal wound models has investigated Tβ4's effects on epithelial healing and inflammation (Sosne et al., 2005).
• Musculoskeletal research: Studies have assessed TB-500 in tendon and muscle injury models in rodents.
Pathway Context
• G-actin sequestration and cytoskeletal dynamics regulation
• HIF-1α stabilization in hypoxic conditions
• VEGF pathway modulation in angiogenesis models
• NF-κB pathway interaction in inflammatory models
• Wt1+ epicardial progenitor cell activation in cardiac models
Preclinical Research
Key preclinical findings with published concentrations:
Smart et al. (2007, Nature): Tβ4 priming activated Wt1+ epicardial progenitor cells in murine myocardial infarction model. Dose: 150 µg injected systemically. Improved neovascularization and reduced scar size.
Malinda et al. (1999): Tβ4 at 100 ng/mL promoted endothelial cell migration (2.5-fold increase) and tube formation in Matrigel assays. EC50 for migration: ~6 nM.
Sosne et al. (2005): Accelerated corneal epithelial wound closure by 25% in rat model. Topical application at 0.1% concentration. Reduced TNF-α and MMP-9 expression.
Philp et al. (2004): Tβ4 at 4.2 mg/kg improved full-thickness dermal wound closure rate by 2-fold in diabetic mouse model.
Typical in vitro concentrations: 1-1000 ng/mL (cell culture). In vivo: 2-6 mg/kg (rodent studies).
All findings from animal or in vitro studies.
Form & Analytical Testing
Form: Lyophilized powder, 5mg per vial
Appearance: White powder
Molecular Weight: 4963.44 g/mol
For In Vitro Research Use Only
Laboratory Preparation:
Add sterile diluent to vial. Gently swirl to dissolve.
Solubility Profile: Freely soluble in water (>20 mg/mL), PBS, cell culture media.
Stability: Lyophilized stable 24 months at -20°C. Solution: 30 days at 2-8°C.
This product is for laboratory and in vitro research only. Not for human or animal use.
Article Author
DS
Article Author
Dr. Sarah Chen, Ph.D.
Biochemistry researcher specializing in peptide characterization and analytical chemistry.
This content was prepared for informational purposes based on published preclinical research. It does not constitute medical advice or product efficacy claims.
Citations
1
Smart N, et al. "Thymosin beta4 induces adult epicardial progenitor mobilization and neovascularization." Nature. 2007;445(7124):177-82. PubMed: 17108969PubMed
2
Malinda KM, et al. "Thymosin beta4 accelerates wound healing." J Invest Dermatol. 1999;113(3):364-8. PubMed: 10469334PubMed
3
Sosne G, et al. "Thymosin beta 4 promotes corneal wound healing and modulates inflammatory mediators in vivo." Exp Eye Res. 2005;81(1):23-9. PubMed: 15978250PubMed
4
Philp D, et al. "Thymosin beta4 increases hair growth by activation of hair follicle stem cells." FASEB J. 2004;18(2):385-7. PubMed: 14657001PubMed
RUO Disclaimer
ALL ARTICLES AND PRODUCT INFORMATION ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY. Products are for in-vitro studies only. Not approved by the FDA. Bodily introduction strictly forbidden. These products are not drugs, supplements, food, or cosmetics and may not be acquired for such purposes.
Advancing Research, One Peptide at a Time
Premium quality. Rigorous testing. Trusted by researchers worldwide.
Properties
Molecular Formula
C212H350N56O78S
Molecular Weight
4963.44 g/mol
Monoisotopic Mass
4960.50
Polar Area
414 Ų
Complexity
1530
XLogP
-8.6
Heavy Atoms
347
H-Bond Donors
62
H-Bond Acceptors
84
Rotatable Bonds
194
Identifiers
PubChem CID
16132341
InChIKey
HBOMLICNUCNMMY-XLPZGREQSA-N
SMILES
Large peptide - see PubChem CID 16132341 for full SMILES
Lyophilized: -20°C, protected from light
Reconstituted: 2-8°C
Shelf Life
24 months lyophilized at -20°C
30 days reconstituted at 2-8°C
Handling
Allow vial to reach room temperature before opening.
Reconstitute with bacteriostatic water.
Avoid repeated freeze-thaw cycles.
Frequently Asked Questions
TB-500 is verified at ≥99.1% purity via reverse-phase HPLC analysis. Each batch also undergoes ESI mass spectrometry for identity confirmation, LAL endotoxin testing (<0.1 EU/mg), and USP <71> sterility testing. A batch-specific Certificate of Analysis (COA) is included with every order.
Add bacteriostatic water (0.9% benzyl alcohol) slowly to the vial wall. Gently swirl to dissolve — do not shake or vortex. Reconstituted peptide should be stored at 2-8°C and used within 30 days. For single-use applications, sterile water may be substituted (no preservative, use immediately).
Lyophilized (powder): Store at -20°C, protected from light and moisture. Shelf life: 24 months. Reconstituted (solution): Store at 2-8°C, use within 30 days. Critical: Allow the vial to reach room temperature before opening to prevent moisture condensation inside the vial. Avoid repeated freeze-thaw cycles (max 3 recommended).
The CAS registry number for TB-500 is 77591-33-4. Molecular weight: 4963.44 g/mol. Molecular formula: C212H350N56O78S. Full chemical characterization data including PubChem identifiers, SMILES notation, and InChIKey are available on the Chemical Properties tab above.
Yes. Every batch of TB-500 is independently tested by Janssen Analytical Laboratories (ISO 17025-accredited). Testing includes HPLC purity analysis, mass spectrometry identity confirmation, LAL kinetic turbidimetric endotoxin assay, and USP <71> sterility testing. Full results are provided in the batch-specific COA. Additional documentation is available on the COA/HPLC/MS and 3rd Party Testing tabs above.
Orders placed before 2:00 PM EST ship same day via cold-chain logistics with gel ice packs to maintain product integrity during transit. Most domestic orders arrive within 2-4 business days. Full tracking is provided. All vials are sealed under inert atmosphere and packaged to prevent damage.
Yes. Tiered pricing is applied automatically at checkout: 2+ units at 10% off, 3+ units at 15% off, and 5+ units at 20% off. For institutional or bulk research inquiries (10+ vials), contact us at contact@aureumpeptides.com for custom pricing.
Compatibility depends on your specific experimental design. TB-500 is provided as a single-compound lyophilized preparation for maximum flexibility. When using multiple compounds, reconstitute each separately and add to experimental systems independently to avoid potential interactions during reconstitution. Check the "Researchers Also Purchased" section below for commonly paired research compounds.
Stay at the Forefront
Join our research community. Get early access to new peptides, exclusive member pricing, and curated literature reviews delivered to your inbox.
Welcome to the Circle ✦
Check your inbox for your 10% welcome discount
No spam, everUnsubscribe anytime12,000+ researchers
TB-500$33.00–$97.00Price range: $33.00 through $97.00
CA Prop 65: WARNING: This product can expose you to chemicals known to the State of California to cause cancer, birth defects, or other reproductive harm. P65Warnings.ca.gov
Side-by-side analysis of chemical profiles, research applications, and specifications
All products are sold strictly for in vitro research and laboratory use. Not for human consumption, therapeutic use, or veterinary use. No statements on this website have been evaluated by the FDA. Products are not intended to diagnose, treat, cure, or prevent any disease. By purchasing, you confirm you are a qualified researcher and agree to our Terms of Service. CA Prop 65 Warning: Products may contain chemicals known to the State of California to cause cancer or reproductive harm.
Research Grade Peptides
USA Based
Same-Day Shipping
99%+ Purity Verified
Stay Informed
Get research updates, new product alerts, and exclusive offers delivered to your inbox.
No spam. Research content only. Unsubscribe anytime.
All products are sold strictly for laboratory research and in-vitro testing. Not for human consumption.
Product Comparison
Join the Aureum Research Community
Get early access to new compounds, exclusive protocols, and research updates.
TB-500 from Aureum Peptides is synthesized to ≥99% purity and verified by third-party HPLC analysis. A Certificate of Analysis (COA) is included with every order.
Is TB-500 intended for human use?+
No. TB-500 is sold strictly for in-vitro laboratory research purposes only. Not for human consumption, therapeutic use, or veterinary use. Purchase is limited to qualified researchers and research facilities.
How is TB-500 shipped and stored?+
Orders placed before 2:00 PM EST ship the same business day from our USA facility with cold-chain logistics. Upon arrival, store TB-500 lyophilized at -20°C for long-term stability, or at 4°C for short-term storage after reconstitution.
Do you provide a Certificate of Analysis?+
Yes. Every vial of TB-500 ships with a batch-specific Certificate of Analysis documenting identity (mass spectrometry), purity (HPLC), and appearance. COAs are also accessible via our online COA portal using the batch number on your vial.
Can I order TB-500 in bulk for institutional research?+
Yes. Aureum Peptides offers institutional wholesale pricing for universities, biotech R&D, and contract research organizations. Contact us for a quote and Net-30 payment terms after credit approval.
No reviews yet. Be the first to share your experience with this product.
Write a Review
Review Guidelines: Reviews must relate to product quality, packaging, shipping experience, and research-grade specifications only. Reviews describing personal use, health effects, or therapeutic outcomes will not be published.
All reviews are moderated before publication to ensure compliance with research-use-only guidelines.